Myotoxin

Erweiterte Suche

(Weitergeleitet von Myotoxine)
Dreidimensionale Struktur von Crotamin, einem Myotoxin, das auf Natriumkanäle wirkt, nach PDB 1H5O.[1] Die Cysteine, die Disulfidbrücken ausbilden, wurden hervorgehoben.

Myotoxin (aus altgriech. μῦς mys, Gen. μυός myos ‚Muskel‘ und τοξίνη, altgriechisch ausgesprochen toxíne ‚die giftige Substanz‘, zusammen genommen Muskelgift) ist ein Schlangengift-Peptid mit muskellähmender und -zerstörender Funktion. Speziell im Gift der Klapperschlangen (Crotalus) findet man verschiedene, homologe Peptide, die diese Funktion aufweisen.

Geschichte

Crotalus durissus terrificus (Schauer-Klapperschlange)

Der brasilianische Wissenschaftler José Moura Gonçalves reinigte und identifizierte in den 1950er Jahren das erste Myotoxin, Crotamin, aus dem Gift der Schauer-Klapperschlange (Crotalus durissus terrificus), einer tropischen Klapperschlange, die in Südamerika heimisch ist.

Struktur und Funktion

Strukturell sehr ähnliche Myotoxine – alle sind kleine, basische Peptide mit Molekülmassen um 4,5 kDa, isoelektrischen Punkten (pI) um 9,8 und strukturstabilisiert durch drei Disulfidbrücken – liegen im Gift von Grubenottern und Vipern vor.[2][3] Die Myotoxine führen beim Beutetier zu einer Muskellähmung (Myotoxizität) und verhindern die Flucht. Innerhalb von Minuten tritt dann der Tod durch Lähmung der Bauchatmung ein sowie durch einen weiteren nicht-enzymatischen Mechanismus, der zum lokalen Absterben des Muskelgewebes (Myonekrose) führt.

Sequenzhomologie

Myotoxine aus verschiedenen Schlangengiften sind vor allem in den 1960er bis 1980er Jahren isoliert und charakterisiert worden. Der Vergleich ihrer Aminosäuresequenzen zeigt einen hohen Grad an Sequenzhomologie und den auch in den Abständen konservativen Erhalt der drei Cystine (sechs Cysteine, die drei Disulfidbrücken bilden: Cys4-Cys36, Cys11-Cys30 und Cys18-Cys37[4]), die die Struktur des Myosinmoleküls stabilisieren (gelb: Cystein; grün: homologe (identische) Aminosäuresequenz):

Bezeichnung
Aminosäuresequenz (Einbuchstabencode) Spezies (Crotalus)
Crotamin[5] YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG C. durissus terrificus
Myotoxin I[6] YKRCHKKEGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKGSVN C. viridis concolor
Myotoxin II[6] YKRCHKKGGHCFPKEKICTPPSSDFGKMDCRWKWKCCKKGSVN C. viridis concolor
Myotoxin II m.[6] YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVN C. viridis concolor
Peptid c[7] YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWKWKCCKKSVN C. viridis helleri
Myotoxin a[8] YKQCHKKGGHCFPKEKICIPPSSDLGKMDCRWKWKCCKKGSG C. viridis viridis
CAM[9] YKRCHKKGGHCFPKTVICLPPSSDFGKMDCRWRWKCCKKGSVNN C. adamanteus

Einzelnachweise

  1. G. Nicastro, L. Franzoni, C. de Chiara, A. C. Mancin, J. R. Giglio, A. Spisni Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom (PDF), Eur J Biochem 270 (9), S. 1969–1979 (2003). PMID 12709056.
  2. P. R. Griffin, S. D. Aird A new small myotoxin from the venom of the prairie rattlesnake (Crotalus viridis viridis), FEBS Lett., Vol. 274, S. 43–47 (1990). PMID 2253781.
  3. Y. Samejima, Y. Aoki, D. Mebs Amino acid sequence of a myotoxin from venom of the eastern diamondback rattlesnake (Crotalus adamanteus), Toxicon, Vol. 29, S. 461–468 (1991). PMID 1862521.
  4. V. Fadel, P. Bettendorff, T. Herrmann, W. F. de Azevedo Jr., E. B. Oliveira, T. Yamane und K. Wüthrich Automated NMR structure determination and disulfide bond identification of the myotoxin crotamine from Crotalus durissus terrificus, Toxicon (2005) 1;46(7):759–767. PMID 16185738.
  5. J. C. Laure Die Primärstruktur des Crotamins, Hoppe-Seylers Z. Physiol. Chem. (1975), Band 246, S. 799–803. doi:10.1515/bchm2.1975.356.1.213
  6. 6,0 6,1 6,2 A. L. Bieber, R. H. McParland und R. R. Becker Amino acid sequences of myotoxins from „Crotalus viridis concolor“ venom, Toxicon (1987), Band 25, S. 677–680. PMID 3629618.
  7. N. Maeda und N. Tamiya Some chemical properties of the venom of the rattlesnake, „Crotalus viridis helleri“, Toxicon (1978), Band 16, S. 431–441. PMID 694946.
  8. J. W. Fox, M. Elzinga und A. T. Tu Amino acid sequence and disulfide bond assignment of myotoxin a isolated from the venom of prairie ratttlesnake („Crotalus viridis viridis“), Biochemistry (1979), Band 18, S. 678–684. PMID 570412.
  9. Y. Samejima, Y. Aoki und D. Mebs Structural studies on a myotoxin from „Crotalus adamanteus“ venom in Progress in Venom and Toxin Research (1988), S. 186–187, P. Gopalakkrishnakone und C. K. Tan (Hrsg.), Natl. Univ. Singapore Press, Singapore.

Literatur

  • Alan L. Harvey (Hrsg.): Snake Toxins, International Encyclopedia of Pharmacology and Therapeutics, Sect. 134, Pergamon Press, New York, Oxford, Beijing, Frankfurt, São Paulo, Sydney, Tokyo, Toronto 1991, S. 70–71 (allgemein), S. 118–119 (Mechanismus), S. 120–121 (Struktur/Aktivität); S. 394–395 (Klonierung); S. 435 (Sequenzen).

Diese Artikel könnten dir auch gefallen

Die letzten News aus den Naturwissenschaften

05.08.2021
Sonnensysteme - Exoplaneten
Superflares: für Exoplaneten weniger gefährlich als gedacht
Superflares, extreme Strahlungsausbrüche von Sternen, standen bisher im Verdacht, den Atmosphären und damit der Habitabilität von Exoplaneten nachhaltig zu schaden.
29.07.2021
Akustik - Optik - Wellenlehre
„Spin“ einer Nanoschallwelle erstmals in Echtzeit nachgewiesen
Einem deutsch-amerikanischen Forscherteam ist es gelungen, die rollende Bewegung einer Nanoschallwelle nachzuweisen. Diese hatter der Physiker und Nobelpreisträger Lord Rayleigh 1885 vorhergesagt.
27.07.2021
Monde - Thermodynamik
Wasserdampf-Atmosphäre auf dem Jupitermond Ganymed
Internationales Team entdeckt eine Wasserdampfatmosphäre auf der sonnenzugewandten Seite des Mondes Jupiter-Mondes Ganymed. Die Beobachtungen wurden mit Hubble-Teleskop gemacht.
27.07.2021
Quantenphysik - Thermodynamik
Der Quantenkühlschrank
An der TU Wien wurde ein völlig neues Kühlkonzept erfunden. Computersimulationen zeigen, wie man Quantenfelder verwenden könnte, um Tieftemperatur-Rekorde zu brechen.
27.07.2021
Klassische Mechanik - Physikdidaktik
Warum Bierdeckel nicht geradeaus fliegen
Wer schon einmal daran gescheitert ist, einen Bierdeckel in einen Hut zu werfen, sollte nun aufhorchen: Physiker der Universität Bonn haben herausgefunden, warum diese Aufgabe so schwierig ist.
23.07.2021
Quantenphysik - Biophysik
Topologie in der Biologie
Ein aus Quantensystemen bekanntes Phänomen wurde nun auch im Zusammenhang mit biologischen Systemen beschrieben: In einer neuen Studie zeigen Forscher dass der Begriff des topologischen Schutzes auch für biochemische Netzwerke gelten kann.
22.07.2021
Galaxien
Nadel im Heuhaufen: Planetarische Nebel in entfernten Galaxien
Mit Daten des Instruments MUSE gelang Forschern die Detektion von extrem lichtschwachen planetarischen Nebeln in weit entfernten Galaxien.
21.07.2021
Sonnensysteme - Sterne
Langperiodische Schwingungen der Sonne entdeckt
Ein Forschungsteam hat globale Schwingungen der Sonne mit sehr langen Perioden, vergleichbar mit der 27-tägigen Rotationsperiode der Sonne, entdeckt.
20.07.2021
Festkörperphysik - Thermodynamik
Ein Stoff, zwei Flüssigkeiten: Wasser
Wasser verdankt seine besonderen Eigenschaften möglicherweise der Tatsache, dass es aus zwei verschiedenen Flüssigkeiten besteht.
19.07.2021
Galaxien - Schwarze_Löcher
Ins dunkle Herz von Centaurus A
Ein internationales Forscherteam hat das Herz der nahegelegenen Radiogalaxie Centaurus A in vorher nicht erreichter Genauigkeit abgebildet.